ubiquitin fusion protein
Chromosome IV: 5,497,893-5,499,079 reverse strand.
This transcript has 5 exons and is annotated with 15 domains and features.
This transcript is a product of gene NCU05275 Show transcript tableHide transcript table
.
.
ubiquitin fusion protein
Chromosome IV: 5,497,893-5,499,079 reverse strand.
This transcript has 5 exons and is annotated with 15 domains and features.
This transcript is a product of gene NCU05275 Show transcript tableHide transcript table
Name | Transcript ID | bp | Protein | Biotype | UniProt | RefSeq | Flags |
---|---|---|---|---|---|---|---|
- | EAA32676 | 789 | 128aa | Gene/transcipt that contains an open reading frame (ORF).Protein coding | P0C224 | - | A single transcript chosen for a gene which is the most conserved, most highly expressed, has the longest coding sequence and is represented in other key resources, such as NCBI and UniProt. This is defined in detail on http://www.ensembl.org/info/genome/genebuild/canonical.htmlEnsembl Canonical, |
.
MQIFVKTLTGKTITLEVESSDTIDNVKQKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGIIEPSLKALASKFNCDKMICRKCYARLPPRATNCRKRKCGHTNQ LRPKKKLK
.
.
Ensembl Fungi release 60 - October 2024 © EMBL-EBI EMBL-EBI
.
.
This website requires cookies, and the limited processing of your personal data in order to function. By using the site you are agreeing to this as outlined in our Privacy Policy and Terms of Use